Loading...
Statistics

Electronic Photo-Imaging @ the EPIcentre
www.epi-centre.com/
Electronic Photo-Imaging's EPIcentre is dedicated to the Art and Science of Digital Imaging. EPI builds bridges between established, emerging and future ...

Epi-centre.com

Conversion Technology Metas Server
Epi-centre.com is hosted in United Kingdom . Epi-centre.com uses HTTPS protocol. Number of used technologies: 2. First technologies: Javascript, Php, Number of used javascripts: 0. First javascripts: Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache.

Technologies in use by Epi-centre.com

Technology

Number of occurences: 2
  • Javascript
  • Php

Javascripts

Number of occurences: 0

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Google Analytics ID

  • UA-78778699-1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Epi-centre.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.123-secure.com
    • subject:
      • OU: Domain Control Validated
      • CN: *.123-secure.com
    • hash: 0501ca7f
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: GlobalSign Domain Validation CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492231843103159937762890595815297314772501
    • validFrom: 150417132039Z
    • validTo: 180417132039Z
    • validFrom_time_t: 1429276839
    • validTo_time_t: 1523971239
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:*.123-secure.com, DNS:123-secure.com
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl.globalsign.com/gs/gsdomainvalsha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure.globalsign.com/cacert/gsdomainvalsha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsdomainvalsha2g2
      • subjectKeyIdentifier: C1:F6:75:D2:58:01:15:B6:E3:8A:86:8E:FA:91:2D:C3:4D:A4:FC:F7
      • authorityKeyIdentifier: keyid:EA:4E:7C:D4:80:2D:E5:15:81:86:26:8C:82:6D:C0:98:A4:CF:97:0F

Meta - Epi-centre.com

Number of occurences: 2
  • Name: DESCRIPTION
    Content: Electronic Photo-Imaging's EPIcentre is dedicated to the Art and Science of Digital Imaging. EPI builds bridges between established, emerging and future technological techniques and cultures, while exploring and fostering a profitable understanding of the rich opportunities which they offer. The EPI mission is to impart a greater understanding of the direction in which technology is moving, to provide the knowledge required to assess the significance of innovations, to assess risks and rewards, and when best to invest in the new technology.
  • Name: KEYWORDS
    Content: John Henshall, J M Henshall, Henshall, Electronic Photo-Imaging, Electronic Photo Imaging, EPIcentre, digital imaging, digital imaging, digital imaging, digital imaging, digital imaging, digital imaging, electronic imaging, electronic photo imaging, digital photo imaging, John Henshall, Dave Pattison, photo electronic imaging, photo imaging, photo, photography, photographer, course, courses, seminar, workshop, consultant, consultancy, expert witness, witness, image, imaging, camera, digital camera, digital camera, digital camera, digital cameras, digital cameras, digital cameras, film, television, digital television, video, digital video, moving image, cinematography, image makers, forensic, picture, pixel, pix, pics, Stanford in the Vale, Oxfordshire, Oxford

Server / Hosting

  • IP: 94.136.40.103
  • Latitude: 51.50
  • Longitude: -0.12
  • Country: United Kingdom

Rname

  • ns24.worldnic.com
  • ns23.worldnic.com
  • aspmx2.googlemail.com
  • aspmx.l.google.com
  • aspmx3.googlemail.com
  • alt2.aspmx.l.google.com
  • alt1.aspmx.l.google.com

Target

  • namehost.WORLDNIC.com

HTTP Header Response

HTTP/1.1 200 OK Date: Sat, 23 Jul 2016 02:25:44 GMT Server: Apache Last-Modified: Sat, 04 Jun 2016 23:43:38 GMT ETag: "6a2dbb0-3473-5347c688b1bd3" Accept-Ranges: bytes Content-Length: 13427 Vary: Accept-Encoding,User-Agent Content-Type: text/html X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Via: 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive

DNS

host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: A
  4. ip: 94.136.40.103
host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: NS
  4. target: ns24.worldnic.com
host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: NS
  4. target: ns23.worldnic.com
host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: SOA
  4. mname: NS23.WORLDNIC.com
  5. rname: namehost.WORLDNIC.com
  6. serial: 113060613
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 3600
host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: MX
  4. pri: 10
  5. target: aspmx2.googlemail.com
host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: MX
  4. pri: 1
  5. target: aspmx.l.google.com
host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: MX
  4. pri: 10
  5. target: aspmx3.googlemail.com
host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: MX
  4. pri: 5
  5. target: alt2.aspmx.l.google.com
host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: MX
  4. pri: 5
  5. target: alt1.aspmx.l.google.com
host: epi-centre.com
  1. class: IN
  2. ttl: 7200
  3. type: TXT
  4. txt: v=spf1 include:_spf.google.com ~all
  5. entries: Array
host: epi-centre.com
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: google-site-verification=Ztc-mav9Xf6YEMUmlYvHIFPEDXoAN3MGif_JWKXnmUs
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.pi-centre.com, www.expi-centre.com, www.xpi-centre.com, www.espi-centre.com, www.spi-centre.com, www.ewpi-centre.com, www.wpi-centre.com, www.erpi-centre.com, www.rpi-centre.com, www.efpi-centre.com, www.fpi-centre.com, www.evpi-centre.com, www.vpi-centre.com, www.ecpi-centre.com, www.cpi-centre.com, www.eqpi-centre.com, www.qpi-centre.com, www.eapi-centre.com, www.api-centre.com, www.eypi-centre.com, www.ypi-centre.com, www.ei-centre.com, www.epii-centre.com, www.eii-centre.com, www.epki-centre.com, www.eki-centre.com, www.epui-centre.com, www.eui-centre.com, www.epji-centre.com, www.eji-centre.com, www.epli-centre.com, www.eli-centre.com, www.ep-centre.com, www.epir-centre.com, www.epr-centre.com, www.epif-centre.com, www.epf-centre.com, www.epiv-centre.com, www.epv-centre.com, www.epik-centre.com, www.epk-centre.com, www.epi,-centre.com, www.ep,-centre.com, www.epib-centre.com, www.epb-centre.com, www.epig-centre.com, www.epg-centre.com, www.epit-centre.com, www.ept-centre.com, www.epiy-centre.com, www.epy-centre.com, www.epiu-centre.com, www.epu-centre.com, www.epij-centre.com, www.epj-centre.com, www.epim-centre.com, www.epm-centre.com, www.epin-centre.com, www.epn-centre.com, www.epicentre.com, www.epi-tcentre.com, www.epitcentre.com, www.epi-gcentre.com, www.epigcentre.com, www.epi-hcentre.com, www.epihcentre.com, www.epi-ucentre.com, www.epiucentre.com, www.epi-jcentre.com, www.epijcentre.com, www.epi-xcentre.com, www.epixcentre.com, www.epi-scentre.com, www.episcentre.com, www.epi-acentre.com, www.epiacentre.com, www.epi-centre.com, www.epicentre.com, www.epi- centre.com, www.epi centre.com, www.epi-entre.com, www.epi-cdentre.com, www.epi-dentre.com, www.epi-crentre.com, www.epi-rentre.com, www.epi-ctentre.com, www.epi-tentre.com, www.epi-cventre.com, www.epi-ventre.com, www.epi-cfentre.com, www.epi-fentre.com, www.epi-cgentre.com, www.epi-gentre.com, www.epi-chentre.com, www.epi-hentre.com, www.epi-cnentre.com, www.epi-nentre.com, www.epi-cmentre.com, www.epi-mentre.com, www.epi-cjentre.com, www.epi-jentre.com, www.epi-cntre.com, www.epi-cexntre.com, www.epi-cxntre.com, www.epi-cesntre.com, www.epi-csntre.com, www.epi-cewntre.com, www.epi-cwntre.com, www.epi-cerntre.com, www.epi-crntre.com, www.epi-cefntre.com, www.epi-cfntre.com, www.epi-cevntre.com, www.epi-cvntre.com, www.epi-cecntre.com, www.epi-ccntre.com, www.epi-ceqntre.com, www.epi-cqntre.com, www.epi-ceantre.com, www.epi-cantre.com, www.epi-ceyntre.com, www.epi-cyntre.com, www.epi-cetre.com, www.epi-cenntre.com, www.epi-centre.com, www.epi-cenhtre.com, www.epi-cehtre.com, www.epi-cenjtre.com, www.epi-cejtre.com, www.epi-cenktre.com, www.epi-cektre.com, www.epi-cenltre.com, www.epi-celtre.com, www.epi-cen tre.com, www.epi-ce tre.com, www.epi-cenre.com, www.epi-centqre.com, www.epi-cenqre.com, www.epi-centare.com, www.epi-cenare.com, www.epi-cent re.com, www.epi-cen re.com, www.epi-centwre.com, www.epi-cenwre.com, www.epi-centere.com, www.epi-cenere.com, www.epi-centzre.com, www.epi-cenzre.com, www.epi-centxre.com, www.epi-cenxre.com, www.epi-centcre.com, www.epi-cencre.com, www.epi-cente.com, www.epi-centrie.com, www.epi-centie.com, www.epi-centroe.com, www.epi-centoe.com, www.epi-centrle.com, www.epi-centle.com, www.epi-centrle.com, www.epi-centle.com, www.epi-centr.e.com, www.epi-cent.e.com,

Other websites we recently analyzed

  1. PLEASANTVIEWFAMILYHEALTHCARE.COM
    Jacksonville (United States) - 205.178.189.131
    Server software: Sun-ONE-Web-Server/6.1
    Technology: Html
    Number of meta tags: 1
  2. 1ï¼…ER TATTOO
    Japan - 210.188.245.26
    Server software: Apache
    Technology: Html, Html5
    Number of meta tags: 1
  3. Medien und Praxishilfen
    Germany - 80.86.88.175
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 4
    Number of meta tags: 2
  4. sandifor.com
    Road Town (Virgin Islands, British) - 208.91.197.25
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  5. danandpro.com
    Scottsdale (United States) - 50.63.202.51
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  6. BeehiveWigs.com
    Kirkland (United States) - 98.124.245.24
    Server software: Apache/2.2.15 (CentOS)
    Technology: Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 3
  7. Home | Telford Junior School
    Telford Junior School
    Dublin (Ireland) - 52.30.143.40
    Server software: Apache/2.4.7 (Ubuntu)
    Technology: CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 7
    Number of meta tags: 7
  8. Coastal Cottage in Amelia Island, FL - Furniture, Home Furnishings
    Coastal Cottage in Amelia Island, Florida or Fernandina Beach, FL has furniture, home furnishings, and gifts along with a custom framing service.
    Edison (United States) - 174.141.224.80
    G Analytics ID: UA-10881283-82
    Server software: Apache/2.2.22 (Unix) mod_ssl/2.2.22 OpenSSL/1.0.0-fips mod_bwlimited/1.4
    Technology: AJAX Libraries API, CSS, Google Font API, Html, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 4
  9. LEF consultants » Home
    De Lier (Netherlands) - 62.197.129.149
    Server software: Apache
    Technology: CSS, Html, Javascript
    Number of Javascript: 5
    Number of meta tags: 4
  10. Casa Giulia | Benvenuto
    Casa Giulia, Bed & Breakfast in the heart of Sorrento Italy
    Arezzo (Italy) - 62.149.140.65
    Server software: squid/3.5.14
    Technology: CSS, Html
    Number of meta tags: 15

Check Other Websites